ignorant nigga shit 2.0
 
  1. Notes: 8561 / 2 months ago 
     
  2. Notes

    1. cheshire-grin reblogged this from scrafty
    2. icondo reblogged this from durreject
    3. cass-attack reblogged this from aestivatee
    4. aestivatee reblogged this from pooq45
    5. pooq45 reblogged this from durreject and added:
      Xbox has the nicest controller imo.
    6. durreject reblogged this from panzertron
    7. platf0rm9and3quarters reblogged this from tvwazhere
    8. someuglyguy reblogged this from tipyourhooker14
    9. tipyourhooker14 reblogged this from steve-and-the-purple-crayon
    10. steve-and-the-purple-crayon reblogged this from desisvicious
    11. pzmdiego reblogged this from nsbg
    12. yuhboyeman reblogged this from iamcrozs
    13. forevershifting reblogged this from imaginationmindgrenade
    14. spankkyyy2091 reblogged this from manuelpyro
    15. salamijoe1 reblogged this from manuelpyro
    16. manuelpyro reblogged this from icecreammikey
    17. balaxe reblogged this from pleatedjeans
    18. ehekic reblogged this from z-tagada
    19. robocupcake reblogged this from mentethemage and added:
      I remember how much I hated the first gen xbox controller. But the 360 one is the best controller I’ve ever held/played...
    20. hpcancel reblogged this from miikachu
    21. smallcityguitar reblogged this from mattfood64
    22. justagirlwithamelody reblogged this from pleatedjeans
    23. ricekrispieswithfrootloops reblogged this from bsmadness
    24. xmiroirdelame reblogged this from sarah-bare
    25. illexplain reblogged this from goforgold93
    26. lowkeycaliswag reblogged this from benjaminshouse
    27. goforgold93 reblogged this from maxybonn
    28. akasha-bennett reblogged this from kokiri-emerald
    29. tjmhw reblogged this from klysmgaming and added:
      Different philosophies of video game controller design.
    30. nerdjosh42 reblogged this from pleatedjeans
    31. blogacus reblogged this from zivjeti
    32. zivjeti reblogged this from jacehouse
    33. theurbanrebellion reblogged this from justin-with-a-j
    34. brosisdavisu reblogged this from absolutescorpio
    35. absolutescorpio reblogged this from thekingcunt
    36. benben777 reblogged this from maxybonn
    37. th3killingjoke reblogged this from luxxrayy
avatar_128
 
 

Leave.

Avada, SolarAvada.

Mobius.

PSN: SolarAvada

I hate on everything known to man.

Kill yourself after following.

 
 

Following

inspiramanationalambiguousattributesfleshliteraturewtfanimethedudelebowskiquixonrealitylapsemkiimichaelflockajordannignoramusnewdeezy2coogihatandadreamnotjeremysweet-princefrozenmochixuicelionofbedstuyblackcathackerkeleezykanyezestdedieuehmzeethe-set-upmanwithpenis128kbs-mp3haitianprophetdeepthroatmomhitshift5timesforstickykeyscerebralescapaderealniggaworldnewsgrandtheftautotuneshit-disturberkennybossthe-goddamn-batmannytunnnelsnakesrulelolquackblacktimtebowthatfuckingcrowkinofuckingketchumv2betachikadeebrutalductapewhoisthisniggabcrippledbypizzahegetsthegirlvideogamenostalgiadoctordarksnackstele-vatorsbarrack-opendatbramamyearsarecoldireniggemptycellsstatehatechaosghostswarmththelasturinebenderpocketabortionsrillehillicitcharmzsawtakugillionairenyeeeeaaaahaverageassemuthefunkeehomosapienhuitcafenahchillhomebroundergroundherofuckyeahthispersoncrapcomlollipopsandpistolspeacefulcalamityohheyitsjazodreamthinkliveskinnymeanbruhthe-long-boxmetrogoonsxckmyegoahighsteppingsatirelickmyybuttproperladymymannemceeviacomcannoncheeto-residue-under-my-foreskinthewearhauszsramaishanelsoncivilrightsbrahkyjunglezstuckonchilljohnwilsonjrdragonwantsabitebosnia-and-herzegovinadixseptdixseptaccellllistenchristianweformlikevoltroniamthedeadpoolkingknightnoteghostkilla-bee-hivehervacationh0medoodoomammaaiselifewonder-benpyrex-visionsimplydop3vouisluittontwopiecenobiscuitparagonalreinaferretmochalattehoelitagamefreaksnzpoeticarsinasesinasupah-ignantscrawledoutdreamskarljrtorresthethirdyawwwwnpapasfritasniggashoeslavenderleetotheumnewdeezycinniiedoomsday519adenoviridaeiampitchforkmediamasterteachervonsocoautumnsayshellowave-greasemithrasmouthnotcaylebeverythingelseisrealchomskiiiwakaflockabodypillowdoyouwantsomelipchapsolarlineceronprimeghost-buddhaneogohanchahlietinycartridgetothosewithwingsfull-metalufakechazachuchillarybanksmegazordprimetextsfrombennettmusicalkitkatkimbosteezyrapindustryfanfictionthe-white-mans-struggleyunghashtagfeministsaresexistgypsytitsmisadventuresofjennmixedbyziggytesientoprivilegedenyingfeministcuntded-beattrillowsmithnostalgicwiththestateofmindmspandrewkwills88patrontruthsskinnywhitekidstickysperm-sockstrespeakbawbsblindiforthekidsallenthomaswantsagunc-speakssoul-sivstabeholdthebroforceanimationsmearsmoleskinechroniclesthespartanwarriortheskysthelimitliberalcrimesquadmisterfeldernuossumsandsigmassquirtelleashleyingeniousmarshkingl7onequote-unquote-gamer-girlsthedrunkenmooglezazeckstaffatribecalledmeayoungbrowngodskipfrombkdevinaachublvcklvndrvidxroptimusrhymesupersnazzyhelmetlittleknownblackhistoryfactsfishwasmadenamethepositionmonstro-pretoa-real-mantyronescholarmomentsbnnybunsgamestormelite-and-discreetbunnycoladalostlittlegamerboitacocatradarnotparagonaltastethemeatnottheheattangerine-embracescedythekidguygamerstntruongblackhistorymothbold-and-brashrblackostricatfairyshloofinterraterworkaholicsstoparkhprojectbeatmesakudostohopewheniswhitehistorymonthweeabasedfykiller7asmodaeusteensexqueenfollowthepathhoodgallerysimplemanipulationnothing-relevant-happens-herestonedkittyhyperbolictimechamberriotingnegroesaestheticbrahayeeenataliesivphilis-deactivatedvaderspubesivanisastupidshitfaggot
 

Tumblr