ignorant nigga shit 2.0, I’m not like most girls.
 
  1. Notes: 132 / 1 month ago  from nahchillhomebro (originally from bonitaputme0n)
    "I’m not like most girls."
    - Most girls (via iammarsz)
  2. Notes

    1. wh108 reblogged this from peacefulcalamity
    2. ravenclawhipster reblogged this from throwaparty
    3. intoxica reblogged this from trespeak
    4. itssimplymeeeee reblogged this from fortheloveof-photography
    5. blahablfuck reblogged this from empresso
    6. wolfarmada reblogged this from sociallyawkwardturkey
    7. infinitends reblogged this from empresso
    8. fortheloveof-photography reblogged this from thenamesluis
    9. sociallyawkwardturkey reblogged this from empresso
    10. carolidoodle reblogged this from skinnymeanbruh
    11. obladi-obladaaa reblogged this from bathingwithapes
    12. heyitsgrimjaw reblogged this from snakelinksonic
    13. l-i-v-r-e-l-e-v-e reblogged this from clitliqu0r
    14. susie-derkins reblogged this from illuminateme
    15. jacksonhagin reblogged this from illuminateme
    16. illuminateme reblogged this from aloneindecember
    17. empresso reblogged this from aloneindecember
    18. aloneindecember reblogged this from thecollinhill
    19. thecollinhill reblogged this from snakelinksonic
    20. jazcazual reblogged this from j-j-jonesy
    21. j-j-jonesy reblogged this from thesensibleheart and added:
      Sigh I know way too many of these girls
    22. whyiliketherobins reblogged this from xtimbabyxfreshallenx
    23. licensed-to-ill reblogged this from sebastienthecrab
    24. applecores reblogged this from kawaiihoodshit
    25. airborne-unicorn reblogged this from throwaparty
    26. feelingsosuperhuman reblogged this from throwaparty
    27. throwaparty reblogged this from please-keep-chasing-me
    28. chrometophobia reblogged this from skinnymeanbruh
    29. nomadicmovements reblogged this from zsram
avatar_128
 
 

Leave.

Avada, SolarAvada.

Mobius.

PSN: SolarAvada

I hate on everything known to man.

Kill yourself after following.

 
 

Following

betachikadeetorresthethirdmusicalkitkathaitianprophethoelitanahchillhomebrothefunkeehomosapiensupersnazzyhelmetnyeeeeaaaahiamthedeadpoolsumsandsigmasdeepthroatmomhuitcafemichaelflockajordancrapcomthe-set-upsweet-princehervacationh0meambiguousattributesthewearhausashleyingeniousweformlikevoltronchomskiiithelasturinebendercrippledbypizzakeleezyreinaniggashoeslavendersquirtellenoteghostmasterteacherdoomsday519fleshliteraturepyrex-visionbarrack-opendatbramadreamthinkliveproperladychillarybankslolquackhitshift5timesforstickykeystinycartridgeprivilegedenyingfeministcuntshit-disturberrapindustryfanfictionyunghashtagquixonmetrogoonlickmyybuttchaosghostpeacefulcalamityxuicedragonwantsabitemyearsarecoldkanyezestcerebralescapaderealitylapsemkiiwakaflockabodypillowbrutalductapetothosewithwingstunnnelsnakesrulegamefreaksnzswarmthtrillowsmithcheeto-residue-under-my-foreskinillicitcharmzbosnia-and-herzegovinatwopiecenobiscuitvouisluittonl7onekyjunglezrillehdoctordarksnacksblackcathackerahighsteppingsatireparagonalskinnymeanbruhufakekarljrmanwithpenisblacktimtebowthatfuckingcrowtele-vatorsrealniggaworldnewsghost-buddhatacocatradarneogohanwhoisthisniggabanimationsmearssawtakuferretmochalattescrawledoutdreamsfeministsaresexistmixedbyziggycinniievideogamenostalgiahegetsthegirlkennybosslittleknownblackhistoryfactsded-beatdedieuthe-goddamn-batmannywave-greaselollipopsandpistolswonder-benaiselifewtfanimemymannemceesxckmyegokinofuckingketchumv2civilrightsbrahmithrasmouthaccelllkwills88misterfeldernewdeezy2kimbosteezydixseptdixseptsimplydop3allenthomaswantsagunireniggnewdeezyemptycellsdoodoomammathespartanwarriorcoogihatandadreamfuckyeahthispersonkingknightstaff128kbs-mp3gypsytitslistenchristianinterraterthedudelebowskigillionaireceronprimechahliestatehateasesinazsramsupah-ignantehmzeegrandtheftautotunenignoramusaishanelsonpatrontruthsatribecalledmebeholdthebroforceadenoviridaemoleskinechroniclesiampitchforkmediaviacomcannonzazecklionofbedstuyskipfrombkthe-white-mans-struggleliberalcrimesquadsoul-sivstanostalgicwiththestateofmindvonsoconamethepositionkudostohopeleetotheumpapasfritasohheyitsjazonotjeremytesientopocketabortionsmegazordprimeayoungbrowngodtrespeakbawbstextsfrombennettcedythekidautumnsayshellotyronescholarmomentsnotcaylebnotparagonaldoyouwantsomelipchapoptimusrhymeworkaholicskilla-bee-hivefrozenmochieverythingelseisrealblindiforthekidsundergroundheromisadventuresofjennostricatfairyshloofquote-unquote-gamer-girlspoeticarsininspiramanationalthe-long-boxstuckonchilljohnwilsonjryawwwwnsolarlinefull-metalchazachumspandrewskinnywhitekidstickysperm-socksc-speakstheskysthelimitnuosmarshkingthedrunkenmoogledevinaachublvcklvndrvidxrfishwasmademonstro-pretoa-real-manbnnybunsgamestormelite-and-discreetbunnycoladalostlittlegamerboitastethemeatnottheheattangerine-embracesguygamerstntruongblackhistorymothbold-and-brashrblackstoparkhprojectbeatmesawheniswhitehistorymonthweeabasedfykiller7asmodaeusteensexqueenfollowthepathhoodgallerysimplemanipulationnothing-relevant-happens-herestonedkittyhyperbolictimechamberriotingnegroesaestheticbrahayeeenataliesivphilis-deactivatedvaderspubesivanisastupidshitfaggot
 

Tumblr